PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009610614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 302aa    MW: 34649.3 Da    PI: 4.5379
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009610614.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.2e-1881134356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++ ++q++ Le+ Fe ++++  e++ +LA++lgL+ rq+ +WFqNrRa++k
  XP_009610614.1  81 KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLAQELGLQPRQIAIWFQNRRARYK 134
                     45578899*********************************************9 PP

2HD-ZIP_I/II124.16.4e-4080171192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl  +qv++LE+sFe ++kLeperKv+la+eLglqprq+a+WFqnrRAR+ktk lEkdy++Lk+++d+lk++ ++L ke+e+Lr+e++
  XP_009610614.1  80 EKKRRLLPNQVQFLEKSFEVDNKLEPERKVQLAQELGLQPRQIAIWFQNRRARYKTKLLEKDYDVLKASFDKLKDDYDSLFKENENLRNEVD 171
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-1868135IPR009057Homeodomain-like
PROSITE profilePS5007117.18476136IPR001356Homeobox domain
SMARTSM003894.6E-1879140IPR001356Homeobox domain
CDDcd000867.51E-1781136No hitNo description
PfamPF000461.9E-1581134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-1884143IPR009057Homeodomain-like
PRINTSPR000315.6E-6107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000315.6E-6116132IPR000047Helix-turn-helix motif
PfamPF021834.1E-15137177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEVGRVKEGS NMSTANSVLP SEVLHNLWMS NSSPSFHGPT SMVNFEDGRG EISKEMSFFS  60
PIDKEETSTD DYDSCFHRPE KKRRLLPNQV QFLEKSFEVD NKLEPERKVQ LAQELGLQPR  120
QIAIWFQNRR ARYKTKLLEK DYDVLKASFD KLKDDYDSLF KENENLRNEV DLLKEKMLRR  180
EKGKENSGQN EPISPVDAEE AQKATPNVVT SEVPSIQKVV CKQEDASSAK SDVIDSDSPH  240
YTDGNHSSNA FEAEPSDFSQ DEDDNLSKSF LCFPEIGDQI QANSCNLGFQ IEDHQPCWFW  300
QY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-118HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610614.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_016442143.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A0V0I6661e-179A0A0V0I666_SOLCH; Putative ovule protein
STRINGPGSC0003DMT4000454711e-176(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-46homeobox 1